PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv2_029330_kios.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family NF-YA
Protein Properties Length: 338aa    MW: 36777.6 Da    PI: 9.3153
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv2_029330_kios.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1041.4e-32173229158
           CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                         +ep+YVNaKQy++Il+RRq+Rak+e ekk+ +ksrkpylheSRh hAlrR+RgsgGrF
  Bv2_029330_kios.t1 173 EEPVYVNAKQYHGILRRRQSRAKAELEKKV-IKSRKPYLHESRHLHALRRARGSGGRF 229
                         69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.6E-37171232IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.657172232IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.9E-28174229IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.6E-24175197IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860177197IPR018362CCAAT-binding factor, conserved site
PRINTSPR006164.6E-24206229IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MPTKAGIVED PFKDEGGAKN MLFGQPWWRG LSNNGVSPTS ASNDSSARSS SGEPVNGSAL  60
AGNFSVPLNG IQDAGGNAGR EIQTVLATQL HKDNTQDQQP LNQVQSSMPQ NLGDQSNAQM  120
ELVGHSIVMT SYPFQDPTYG GAMAYAQVQQ VNPQMYGFQL HQSRMPLPLA MEEEPVYVNA  180
KQYHGILRRR QSRAKAELEK KVIKSRKPYL HESRHLHALR RARGSGGRFL NAKKLDDNNA  240
DNSIKTEANS ATNLQIRSGG SAYSRHVSST YSANAASWNQ QEARESMISD MHKAESHSSN  300
ATNVHGLSST YHSFSGPDEG RDYYGQGGLN LNGALSVK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-21173236265NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010695208.10.0PREDICTED: nuclear transcription factor Y subunit A-4-like
TrEMBLA0A0J8FSZ10.0A0A0J8FSZ1_BETVU; Uncharacterized protein
STRINGVIT_13s0064g00860.t013e-87(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.49e-44nuclear factor Y, subunit A1